PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Dca21465.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Caryophyllaceae; Caryophylleae; Dianthus
Family NAC
Protein Properties Length: 339aa    MW: 38864.3 Da    PI: 7.8864
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Dca21465.1genomeDCAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM161.92.4e-50401683128
         NAM   3 pGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk...kg 97 
                 pGfrFhPtdeelv++yLk+kv++k+l++ e+ik++diyk++PwdL k   + ++kewyf++kr +ky+++ r+nr+t sg+Wkatg d++++s+   ++
  Dca21465.1  40 PGFRFHPTDEELVSFYLKRKVDKKPLSI-EIIKQMDIYKHDPWDLAKvGNSVGDKEWYFYCKRGRKYRNSVRPNRVTGSGFWKATGIDRPIYSNggeGH 137
                 9***************************.89**************8424445899**************************************966555 PP

         NAM  98 elvglkktLvfykgrapkgektdWvmheyrl 128
                 + vglkk+Lv+y+g+a kg+ktdW+mhe+rl
  Dca21465.1 138 RCVGLKKSLVYYRGSAGKGTKTDWMMHEFRL 168
                 66***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.53E-5435201IPR003441NAC domain
PROSITE profilePS5100552.79738201IPR003441NAC domain
PfamPF023659.7E-2540168IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005992Biological Processtrehalose biosynthetic process
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0006561Biological Processproline biosynthetic process
GO:0009718Biological Processanthocyanin-containing compound biosynthetic process
GO:0010120Biological Processcamalexin biosynthetic process
GO:0042538Biological Processhyperosmotic salinity response
GO:1900056Biological Processnegative regulation of leaf senescence
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 339 aa     Download sequence    Send to blast
MDVRSTMSCV SSQDNKDSGG GCGNKDVVVE VVDDHEGPLP GFRFHPTDEE LVSFYLKRKV  60
DKKPLSIEII KQMDIYKHDP WDLAKVGNSV GDKEWYFYCK RGRKYRNSVR PNRVTGSGFW  120
KATGIDRPIY SNGGEGHRCV GLKKSLVYYR GSAGKGTKTD WMMHEFRLPT TEVQKHGINS  180
SISTTNTFEA EIWTLCRIFK RSKKQTPDWR ELSTRRNASN PNSKTSSFDS NHNNERYISF  240
TTRPTLPNNG FYTAVSPDIR ERLSPYDNND MTMDQKNVHF QDNHHQPQSN SVVNLTPTTS  300
NSTMLNVEED YENDFQCFEG HSWEDLTSVV EFAIKTPLL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A4e-454020217169Stress-induced transcription factor NAC1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00310DAPTransfer from AT2G43000Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010693169.11e-133PREDICTED: transcription factor JUNGBRUNNEN 1-like
SwissprotQ9SK555e-85NAC42_ARATH; Transcription factor JUNGBRUNNEN 1
TrEMBLA0A0J8BD731e-134A0A0J8BD73_BETVU; Uncharacterized protein
STRINGGLYMA15G40950.11e-100(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G43000.11e-85NAC domain containing protein 42